13 / 17
Photo 3345
Delaware Lackawanna; Moscow, Pennsylvania
March 22, 2015
delaware lackawannadieselpennsylvaniasnowstation2015portfolio
Books by Steve Barry
Copyright Notice
All images are copyrighted and not part of public domain. Railroad names and logos may be copyrighted by their respective owners and protected by law. No endorsement from any railroad is given or implied. Names are used for identification purposes only. Railroad names and logos appear as incidental parts of each image.
Contact Us!
The best way to reach us is via the contact link in the top navigation bar. Our snail mail office (such as it is) is P.O. Box 817, Swedesboro, NJ 08085. Our phone number is 973/222-5304. Please note that we do not conduct any retail sales via telephone or mail -- retail sales are only handled at the on-line store.
All photographic content © 2018 by Steve Barry
None of the photos are in public domain. Unauthorized usage is a violation of copyright laws.